Strategy 9 min read

What's Included in a $2,000/Month Email Marketing Retainer? (2026 Breakdown)

By Excelohunt Team ·
What's Included in a $2,000/Month Email Marketing Retainer? (2026 Breakdown)

You’ve been doing email marketing yourself — or relying on a basic freelancer — and you’re finally ready to invest in a proper agency retainer. You’ve seen prices ranging from $500/month to $10,000/month and you have no idea what the difference is.

This post is a frank breakdown of what a $2,000/month email marketing retainer actually includes in 2026, what you should expect to receive, and how to tell whether you’re getting real value or paying for someone to press “send” twice a week.

Why $2,000/Month Is a Meaningful Threshold

At $500–$1,000/month, you’re typically paying for basic execution: someone to build a template, write copy, and schedule campaigns. There’s minimal strategy, no real testing, and deliverability is often an afterthought.

At $2,000/month, you’re entering full-service territory. This is where an agency can actually move the needle on your revenue — not just maintain the status quo. For a brand doing $300K–$1M/year in revenue, that retainer should be generating 3–8x its cost in attributable email revenue every month.

If it isn’t, something is wrong.

What’s Included: The Core Deliverables

A well-structured $2,000/month retainer should include all of the following:

1. Platform Management (Klaviyo, Omnisend, or ActiveCampaign)

Your agency should fully own and manage your email platform. This means:

  • List health maintenance (suppression lists, bounce management, unengaged segment exclusions)
  • Deliverability monitoring — tracking inbox placement rates, spam complaint rates, and sender reputation
  • Integration management (Shopify sync, custom events, data layer troubleshooting)
  • Account organization: naming conventions, folder structures, archiving old flows

If your agency is just logging into Klaviyo to schedule campaigns and nothing else, you’re being underserved.

2. Core Automation Flows — Built and Optimized

At $2K/month, you should have all foundational flows built and continuously optimized, not just set-and-forget. The core flows every e-commerce brand needs:

  • Welcome series (3–5 emails, typically 7–14 days): This is your highest-ROI automation. A well-tuned welcome series should convert 5–15% of subscribers into first-time buyers.
  • Abandoned cart (2–3 email sequence): Recovering 5–10% of abandoned carts through email alone is realistic for most brands.
  • Browse abandonment (1–2 emails): Often overlooked but valuable for high-intent visitors.
  • Post-purchase series: Thank you, cross-sell, review request, replenishment reminder depending on your product category.
  • Win-back flow: Re-engaging lapsed customers who haven’t purchased in 90–180 days.

Each of these should be reviewed quarterly at minimum, with split tests running on subject lines, copy, and send timing.

3. Campaign Sends (8–12/Month)

Regular broadcast campaigns keep your list engaged and drive consistent revenue. At $2K/month you should expect 2–3 sends per week, which means:

  • Weekly promotional campaigns (sales, new arrivals, bundles)
  • Content or educational emails when appropriate for your brand
  • Segmented sends to different audience slices (VIP buyers, single-purchase customers, browse-only subscribers)

Generic blasts to your full list are a 2019 strategy. In 2026, every campaign send should at minimum be suppressing unengaged subscribers and ideally be segmented by purchase behavior or engagement tier.

4. Copywriting and Design

This is often where agencies cut corners. At $2K/month, you should receive:

  • Full copy for every campaign and flow email — not a template you fill in yourself
  • On-brand email design, either using a maintained master template or custom HTML layouts
  • Subject line and preview text written for every send (not “RE: Your order” copy-paste)
  • Mobile-optimized rendering across Gmail, Apple Mail, Outlook

If you’re writing your own copy or briefing a junior VA to do it, you’re not getting a full-service retainer.

5. Monthly Reporting and Strategy Calls

A real agency should be reporting on:

  • Revenue attributed to email (campaigns vs. flows breakdown)
  • List growth rate and source breakdown
  • Open rates, click rates, and conversion rates benchmarked against your category
  • Deliverability metrics (inbox placement, spam complaints)
  • Test results and what’s being changed based on data

You should have a 30–60 minute call monthly to review results, align on upcoming promotions, and discuss strategy. If your agency only communicates via Slack and you haven’t spoken to a strategist in 2 months, that’s a red flag.

What’s Usually NOT Included at $2,000/Month

Being clear about scope matters. At this price point, you typically won’t get:

  • SMS marketing: SMS management (via Klaviyo SMS, Postscript, or Attentive) is usually a separate add-on — often $500–$1,000/month more depending on volume.
  • List building strategy: Landing page design, pop-up optimization, and paid list growth campaigns are typically outside scope unless specifically agreed.
  • Paid email acquisition: Facebook/Meta lead gen campaigns to grow your email list aren’t part of email management.
  • Advanced custom development: Complex custom integrations or bespoke HTML coding beyond standard templates.

Some agencies bundle these; most don’t. Ask specifically what’s in scope before signing.

Agency vs. Freelancer: The Real Difference at $2K/Month

A freelancer charging $2,000/month is typically one person doing everything — strategy, design, copy, and execution. When they get sick, go on holiday, or land a bigger client, you feel it. There’s no backup, no peer review, and usually limited strategic depth.

An agency at $2,000/month should have a dedicated strategist overseeing your account, a copywriter, and a designer — even if these roles have overlap. The account is not dependent on a single person, and there’s institutional knowledge built up over time.

The other key difference: agencies working with 20–50 e-commerce brands in parallel have benchmarks and pattern recognition that a solo freelancer simply can’t develop. When we at Excelohunt see a client’s welcome series converting at 3% we know immediately that’s below par — because we see what “good” looks like across dozens of similar accounts.

Signs You’re Getting Good Value from Your Retainer

  • Email is driving 20–35% of your total store revenue (check Klaviyo’s attribution dashboard)
  • Your abandoned cart flow has a 5%+ conversion rate
  • Your sender reputation score in Google Postmaster is “High”
  • You receive proactive recommendations, not just execution of what you ask for
  • Your list is growing month over month without you doing anything special

Signs You’re Not Getting Value

  • Your agency sends campaigns but has never mentioned deliverability
  • Flows were built once on day one and haven’t been touched
  • Monthly reporting is a screenshot of the Klaviyo dashboard with no analysis
  • You don’t know what your email revenue attribution is
  • Your agency responds to briefs but never initiates ideas

The Right Investment Level for Your Brand

For brands doing $200K–$1M/year in revenue, a $2,000/month email retainer is the sweet spot. You’re investing enough to get real expertise and consistent execution, but you’re not overinvesting relative to your scale.

At $500K+ ARR, you should be pushing toward $3,000–$5,000/month to unlock advanced segmentation, more campaign sends, dedicated reporting, and potentially SMS integration.

At $1M+ ARR, email marketing is a significant revenue driver and should be treated as such — $5,000–$10,000/month with a senior strategist is appropriate.


If you’re currently spending $2,000/month and email is driving less than 15% of your revenue — or you’re not sure what that number is — something is wrong. At Excelohunt, we work with growing e-commerce brands at the $2K–$5K/month range and our benchmark is 25–40% email revenue attribution for brands in the $300K–$2M ARR range.

Get a free email marketing audit →

We’ll review your Klaviyo (or equivalent) account, identify what’s underperforming, and give you a clear picture of what $2,000/month should be delivering for a brand at your stage.

Tags: email-marketingretaineragencypricingklaviyo

Want Us to Implement This for Your Brand?

Get a free email audit and see exactly where you're losing revenue.

Get Your Free Audit
1